Monoclonal antibody for SUR1 and SUR2B |
|
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Ige Monoclonal Laboratories manufactures the ige elevated level monoclonal antibody reagents distributed by Genprice. The Ige Elevated Level Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ige monoclonal. Other Ige products are available in stock. Specificity: Ige Category: Elevated Group: Level Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Level Monoclonal information
Rat Lactation elevated protein 1 (LACE1) ELISA Kit |
|
abx391534-100l |
Abbexa |
100 µl |
Ask for price |
Rat Lactation elevated protein 1 (LACE1) ELISA Kit |
|
abx391534-50l |
Abbexa |
50 µl |
EUR 687.5 |
Rat Lactation elevated protein 1 (LACE1) ELISA Kit |
|
abx391534-96tests |
Abbexa |
96 tests |
EUR 1093.2 |
|
|
Rat Lactation elevated protein 1, LACE1 ELISA Kit |
|
MBS9341131-10x96StripWells |
MyBiosource |
10x96-Strip-Wells |
EUR 6725 |
Rat Lactation elevated protein 1, LACE1 ELISA Kit |
|
MBS9341131-48StripWells |
MyBiosource |
48-Strip-Wells |
EUR 550 |
Rat Lactation elevated protein 1, LACE1 ELISA Kit |
|
MBS9341131-5x96StripWells |
MyBiosource |
5x96-Strip-Wells |
EUR 3420 |
Rat Lactation elevated protein 1, LACE1 ELISA Kit |
|
MBS9341131-96StripWells |
MyBiosource |
96-Strip-Wells |
EUR 765 |
Recombinant Rat Lactation elevated protein 1 (Lace1) |
|
MBS1306217-002mgBaculovirus |
MyBiosource |
0.02mg(Baculovirus) |
EUR 1345 |
Recombinant Rat Lactation elevated protein 1 (Lace1) |
|
MBS1306217-002mgEColi |
MyBiosource |
0.02mg(E-Coli) |
EUR 1045 |
Recombinant Rat Lactation elevated protein 1 (Lace1) |
|
MBS1306217-002mgYeast |
MyBiosource |
0.02mg(Yeast) |
EUR 1140 |
Recombinant Rat Lactation elevated protein 1 (Lace1) |
|
MBS1306217-01mgEColi |
MyBiosource |
0.1mg(E-Coli) |
EUR 1220 |
Recombinant Rat Lactation elevated protein 1 (Lace1) |
|
MBS1306217-01mgYeast |
MyBiosource |
0.1mg(Yeast) |
EUR 1300 |
Human Lactation Elevated Protein 1 (AFG1L) ELISA Kit |
|
abx385075-96tests |
Abbexa |
96 tests |
EUR 687.5 |
|
|
Mouse Lactation elevated protein 2 (LACE1) ELISA Kit |
|
abx389701-1096tests |
Abbexa |
10 × 96 tests |
Ask for price |
Mouse Lactation elevated protein 2 (LACE1) ELISA Kit |
|
abx389701-596tests |
Abbexa |
5 × 96 tests |
Ask for price |
Mouse Lactation elevated protein 2 (LACE1) ELISA Kit |
|
abx389701-96tests |
Abbexa |
96 tests |
EUR 687.5 |
|
|
Mouse Lactation elevated protein 1, Lace1 ELISA KIT |
|
ELI-28039m |
Lifescience Market |
96 Tests |
EUR 1038 |